PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc01047.1.g00100.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family WRKY
Protein Properties Length: 230aa    MW: 25200.7 Da    PI: 8.6963
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc01047.1.g00100.1.sm.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1016.9e-32154212159
                                   ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                          WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                                   ldDgy+WrKYGqK+vk+s +prsY+rCt+++C+vkk+ver ++d ++v++tYeg+H+h+
  Zpz_sc01047.1.g00100.1.sm.mk 154 LDDGYKWRKYGQKVVKNSLHPRSYFRCTHSNCRVKKRVERLSTDCRMVITTYEGRHTHS 212
                                   59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.805.4E-33139212IPR003657WRKY domain
SuperFamilySSF1182906.67E-28146212IPR003657WRKY domain
PROSITE profilePS5081128.564149211IPR003657WRKY domain
SMARTSM007742.7E-37154213IPR003657WRKY domain
PfamPF031068.2E-25155211IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 230 aa     Download sequence    Send to blast
MQAYMEGGQL GTCLPASLVL PDSYAFSFPS PPLQLPTLPK RLLQMPFDQG EAGNHGAMLA  60
SDQGGLHQLP ALPFGCSGAA AVVSGGKPTA GLMPSVEEVC TSVTKVGYEG ATCNGSSTWW  120
KSSATMADRG KMKVRRKMRE PRFCFQTKSD VDVLDDGYKW RKYGQKVVKN SLHPRSYFRC  180
THSNCRVKKR VERLSTDCRM VITTYEGRHT HSPCSDDTAS GDHTDCFSSF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-25145211874Probable WRKY transcription factor 4
2lex_A2e-25145211874Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00618PBMTransfer from AT2G44745Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004953301.11e-121PREDICTED: probable WRKY transcription factor 12
SwissprotQ93WY46e-63WRK12_ARATH; Probable WRKY transcription factor 12
TrEMBLA0A0A9DKW31e-131A0A0A9DKW3_ARUDO; Uncharacterized protein
STRINGSi018283m1e-117(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP113838130
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G44745.18e-64WRKY family protein